PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G17860.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 376aa    MW: 39913 Da    PI: 8.155
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G17860.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.32.4e-19291325135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  OPUNC04G17860.2 291 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 325
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-18285339IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.018285321IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.0E-14288348No hitNo description
Gene3DG3DSA:3.30.50.101.7E-15289323IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.91E-15290347No hitNo description
PfamPF003202.5E-17291325IPR000679Zinc finger, GATA-type
PROSITE patternPS003440291316IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDALKSSCRS EEAADEGAAA APAAWGMVER DGFSVEDLLD LEEFCEAEKD AAEENEQALV  60
VVAAPEESKS KDDSQPSSVV SYELVAPPPP PPEIVDLPAH DVEELEWVSR IMDDSLSELP  120
PPPQPPASVV ASLAARPPQP RPLQRRPQDG AYRALPPASY PVRTPTICAL STEALVPVKA  180
KRSKRSRATA WSLSGAPPFS DSTSSSSTTT TSSCSSSASF SSFSPLLKFE WHPLGGTSDL  240
PEDHLLPPGK KSKHGKNGKN KPKKRGRKPK QLPPHPSGAA AAAPAPGDRR CSHCGVQKTP  300
QWRAGPEGAK TLCNACGVRY KSGRLLPEYR PACSPTFVSA IHSNSHRKVL EMRRKKEVGS  360
GLLTAAAAAA PAVASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0605740.0AK060574.1 Oryza sativa Japonica Group cDNA clone:001-023-D04, full insert sequence.
GenBankAK0991440.0AK099144.1 Oryza sativa Japonica Group cDNA clone:J023055K24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636682.10.0PREDICTED: GATA transcription factor 6
TrEMBLA0A0E0KTB90.0A0A0E0KTB9_ORYPU; Uncharacterized protein
STRINGBGIOSGA016846-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.24e-40GATA transcription factor 5